PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_43361_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 94aa    MW: 10976.3 Da    PI: 8.8749
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_43361_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.1e-19145448
                                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         W++eEdellvd+v++ G+g+W + +++ g++R++k+c++rw +yl
  cra_locus_43361_iso_1_len_281_ver_3  1 WSQEEDELLVDYVNKNGPGNWQSLPKRAGLNRCGKSCRLRWTNYL 45
                                         *******************************************97 PP

2Myb_DNA-binding53.45.8e-175194146
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                         rg++++eE+ +++ ++++ G++ W++Ia++++ gRt++++k++w++
  cra_locus_43361_iso_1_len_281_ver_3 51 RGPFSQEEEAIIISLHRESGNK-WSRIAACLP-GRTDNEIKNYWNT 94
                                         89********************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001676.02E-11145No hitNo description
SuperFamilySSF466891.03E-30192IPR009057Homeodomain-like
PfamPF002494.0E-17145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-24152IPR009057Homeodomain-like
SMARTSM007171.9E-10147IPR001005SANT/Myb domain
PROSITE profilePS5129425.6149IPR017930Myb domain
PROSITE profilePS5129418.6275094IPR017930Myb domain
SMARTSM007176.2E-105094IPR001005SANT/Myb domain
PfamPF002491.9E-155194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-255394IPR009057Homeodomain-like
CDDcd001678.71E-115394No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
WSQEEDELLV DYVNKNGPGN WQSLPKRAGL NRCGKSCRLR WTNYLRPDIK RGPFSQEEEA  60
IIISLHRESG NKWSRIAACL PGRTDNEIKN YWNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-2719430122MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003612858.12e-48myb transcription factor
SwissprotQ9S9K92e-45MYB3_ARATH; Transcription factor MYB3
TrEMBLG7KDP92e-48G7KDP9_MEDTR; Myb transcription factor
TrEMBLW5BUS41e-48W5BUS4_WHEAT; Uncharacterized protein
STRINGBRADI5G16707.11e-47(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154